Tesamorelin and Ipamorelin Blend Product Description The Tesamorelin/Ipamorelin blend combines a synthetic GHRH analogue with a selective growth hormone secretagogue, designed for laboratory research investigating growth hormone regulation pathways. This research compound enables the study of dual-mechanism growth hormone modulation, examining how Tesamorelin’s GHRH-mimicking properties interact with Ipamorelin’s selective ghrelin-like functions in experimental models. This is a (8mg) blend each of Tesmorelin (6mg) and Ipamorelin (2mg). Tesamorelin and Ipamorelin Peptide Structure Tesamorelin Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Molecular Formula: C223H370N72O69S Molecular Weight: 5196 g/mol PubChem CID: 44147413 CAS Number: 901758-09-6 Synonyms: Tesamorelin acetate 901758-09-6 TH9507 UNII-LGW5H38VE3 Tesamorelin acetate [USAN] Ipamorelin Sequence: Aib-His-D-2Nal-D-Phe-Lys Molecular Formula: C38H49N9O5 Molecular Weight: 711.9 g/mol PubChem CID: 9831659 CAS Number: 170851-70-4 Synonyms: 170851-70-4 Ipamorelin [INN] NNC-26-0161 UNII-Y9M3S784Z6 Lyophilized Peptides: These peptides are freeze-dried, a process that not only extends shelf life but also preserves the purity and integrity of the peptides during storage. We do not use any fillers in this process.
