Cagrilintide Description Cagrilintide is a novel long-acting amylin analog featuring N-terminal lipidation that extends its half-life by binding to albumin. This synthetic peptide mimics and enhances natural amylin’s effects, simultaneously targeting multiple metabolic and appetite regulation pathways in both homeostatic and hedonic systems. Peptide Information Property Value Peptide Sequence XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Formula C194H312N54O59S2 Molecular Weight 4409 g/mol CAS Number 1415456-99-3 PubChem CID 171397054 Synonyms 1415456-99-3, Cagrilintide [INN], AO43BIF1U8, LDERDVMBIYGIOI-IZVMHKDJSA-N Cagrilintide Peptide Structure Source: PubChem Lyophilized Peptides: Our cagrilintide is provided as a lyophilized (freeze-dried) powder. This process extends shelf life and preserves the purity and integrity of the peptide without the use of any fillers.
